GenomeNet

>gyc:GYMC61_2991 tgl; transglutaminase (EC:2.3.2.13); K00686 protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13] (A)
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTADGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRPPFIVGTLGSATFLLR

BLAST