GenomeNet

>gym:GYMC10_1195 beta-galactosidase (EC:3.2.1.23); K12111 evolved beta-galactosidase subunit alpha [EC:3.2.1.23] (A)
MKDHRIGRDWDDLSVLERNRAKSRAYFIPFADADGALSYDRGSSAWYQSLNGVWKFHYAE
EPESAPEAFYGEDYDVSAWDDLPVPGHWQLQGYGHPHYTDLYYPFPVDPPHVPNANPTGS
YVREFKLPQHWDGRKICVKFDGVDSAFHVWLNGSFIGYSQGSRLTSEFDLTPYVKPGVNK
MSVRVYQWSDGSYLEDQDMWWMSGIFRDVYLIAEPSALRVNDFRVTTELDAEYRNAKLQV
RLELEGTERGSVQLRLLNGAGAEMGSTGKDVGHSSVENFEIEVAGPDLWSAESPALYHLV
ITLLDNQGETLETVAQRVGFRSIEVKDGQLLVNGRAILLKGVNRHDHHPDTGRTVTLSTM
LEDIRLMKQHNINAVRTAHYPNDPRFYELCDVYGLYVMEETDLETHGFEPLGNISRLSDD
PDWKEAYVDRVRRMVERDKNHPSVLFWSLGNESGFGCNFRAMAEWCREHDPTRLIHYEED
REAEVCDVVSTMYSSVEKMEGFGKMADHPKPHILCEFAHAMGNGPGGLRPYFDAFEAHPR
LAGGFVWEWIDHGLSRRTPDGRMDYAYGGDYGDVPNNSNFVIDGLVRPDRTPSPGLLEYK
KVIEPVRMSMRRHGVLHIMNRYDFISLDHLQAHYRVLSDGQLVHSEALDLPRIEAGTSAE
LSLLKALEQATIGVNPFAELWLEVSLSLAADCRWAERGHEVAWSQFLLRESSKPEFEPTA
ALQRGALQISEEKHGLHVGNGSFQLSLSALHAGFETLSMHGKRIALGGPALNFWRPPIDN
DMYVLPDWRKAHLDRLSERVDHFEWKRLDRECVEVKRVSRIAPPVYDWGFRCETTYTITS
SGLIIIDVKGEPIGTPPGMLPKIGLQMQVAGDMEHVRWYGRGPGESYPDSLEAGRFGEYR
STVDGLFTPYIYPQENGNRSDVRWVSLADGAGLGLLAVGEPSLNFSASRYTDQDVESAAH
ASDLVPQRFITLNLDYRQNGLGSNSCGPAQAPEHSIKPEPFSFRMLLKPYAAEDTDPVRL
SRRMRSEAGLYE

BLAST