GenomeNet

>hac:Hac_0188 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) typeIIS restriction enzyme (A)
MQLSQHNRYDQNKIKIIIQAIFNEVGEDFLQIRTTDMSKRPSNITGEEIYAKVVDNICKS
EISQDNLGKKNQVAQDSLRKNLFVDMHRMGLIERYNKNKELIDPYIQSNIKYIRLTPLAI
EFLNAQDLLRKNFCYTQALENLLKGFGAECREVMIGLDNHHLDIEEMMFFVTFLNIENFT
RSEIIEYVREYRSLSRIQKEKLKESVQNYCNPNHFSGNKLNKRDYHNWKNQAQQIFSLLE
QSVFFETNKERLILKTISEENKQNDKKLKRSIKEKALYFEKHGVKKEKGFELHHIVPLCL
ARSSIEEFDLLDKWENLIYIDAFNHAKISQTQNKHICLYFKNCDVILSKGFKEEQESLYL
TYIENVSYKLDLQNTMLEYNKDLLHSKNG

BLAST