GenomeNet

>hac:Hac_0305 ulcer-associated gene restriction endonuclease (EC:3.1.21.4); K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MEFDKEQTPRNSIDRIRLNGYNTKCVFNQSIRQDIKNHYSQQCCAMCGVWGNSENTQIEV
DHKDGRKNDPRVSDLSMQTLDDFQALCKACNDKKRQICKECKETGYRFDATKILGNHYPF
YEGEAEYDGCVGCYQYDPIQYKKTCNDRIYNEGYQKGYDEGYQIGYHQKTTL

BLAST