GenomeNet

>hac:Hac_0305 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) ulcer-associated gene restriction endonuclease (A)
MEFDKEQTPRNSIDRIRLNGYNTKCVFNQSIRQDIKNHYSQQCCAMCGVWGNSENTQIEV
DHKDGRKNDPRVSDLSMQTLDDFQALCKACNDKKRQICKECKETGYRFDATKILGNHYPF
YEGEAEYDGCVGCYQYDPIQYKKTCNDRIYNEGYQKGYDEGYQIGYHQKTTL

BLAST