GenomeNet

>hac:Hac_1313 hypothetical protein; K01775 alanine racemase [EC:5.1.1.1] (A)
MLRRASFVEVDTSSLRHNFHAAKNAIPKDAHIMAVVKANAYGVGALKASEVFLQEGAHYL
GVATLDEALELRSCFPKTPILILGYSPNSNAQMLIDNNLTAMIFSLEQAGVFSQAALKSQ
KHLKVHLKIDTGMHRLGLEPNFKSIEMIKKIRALNGLEVEGIFTHLSNANANIKTHAKNQ
MKIFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNNNENRFLNLYRPGIMLYGFYPSNEMK
QSCQTILNNVVSLKAKIVQIKRVKKGEFVGYGKHFYTNEETLIGTLALGYADGLVRDLGN
RIQVAINNQLAPLIGKVCMDQCFVKLDGIEAKEGDEVILFGDKSTKANDANEIAMLLNTI
PYETISTLSKRLERVYV

BLAST