GenomeNet

>hac:Hac_1313 unnamed protein product; (Q9ZKQ9) Alanine racemase (EC 5.1.1.1); High confidence in function and specificity (EC:5.1.1.1); K01775 alanine racemase [EC:5.1.1.1] (A)
MLRRASFVEVDTSSLRHNFHAAKNAIPKDAHIMAVVKANAYGVGALKASEVFLQEGAHYL
GVATLDEALELRSCFPKTPILILGYSPNSNAQMLIDNNLTAMIFSLEQAGVFSQAALKSQ
KHLKVHLKIDTGMHRLGLEPNFKSIEMIKKIRALNGLEVEGIFTHLSNANANIKTHAKNQ
MKIFNAFLEQLLDQKIEFQYRHAYNSAGILSLCNNNENRFLNLYRPGIMLYGFYPSNEMK
QSCQTILNNVVSLKAKIVQIKRVKKGEFVGYGKHFYTNEETLIGTLALGYADGLVRDLGN
RIQVAINNQLAPLIGKVCMDQCFVKLDGIEAKEGDEVILFGDKSTKANDANEIAMLLNTI
PYETISTLSKRLERVYV

BLAST