GenomeNet

>har:HEAR0313 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) Putative glutathione S-transferase (GST-like protein) (EC:2.5.1.18) (A)
MKLIGSLASPYVRKVRVVMLEKKIDYDFVLENVWSPDTLIQESNPLGKVPCLVMEDGGAM
FDSRVIVEYLDTLTPVGKLIPAHGRERAEVKCWEALADGVCDAAMLLRLEHTLRPAEQRS
QSWIDRQTAKVNAGLKAMSTGLKDTAFCAGNQYTLADVAVGCTLEWLTFRFPEITWRTEY
PNLEKMLEKLSERPSFKETSPK

BLAST