GenomeNet

>hbo:Hbor_21570 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) ribulose 1,5-bisphosphate carboxylase large subunit (A)
MAGITYEDFLDLSYEPDESDLVCTFRIAPAEGMDVEAAASRVASESSNGTWAALPTGEGF
TDMGATTFDIRGSDDSAEVDVAYPAGLFEPGSMPQILSCIAGNIMGMKAVDTIRLADCQW
PEALVSSFAGPQFGSSVREEIFGIEEDRPILATVPKPKVGLSTDRHAEVGYEAWLGGVDL
LKDDENLTDQSFNPYHDRLVESLALRDDAEDETGEKKSYLINVTADTNTMLERVDLAAEE
GCEYVMVDVITTGWAAVQTVRERCEDHGIAIHAHRAMHAAFDRLENHGVSMRVLAQISRL
CGVDQLHTGTAGLGKLANEDTVGINDWMRSELYGLNDVLPVASGGLHPGLIPDLLDATGT
NVCVQAGGGIHGHPDGTRAGAAALRAAVDGYAAGKSLEESADDSPELATAIDEWGTETPR

BLAST