GenomeNet

>hbu:Hbut_0487 K01622 fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11] | (GenBank) universally conserved uncharacterized protein (A)
MGEERRVTISVIKADIGSIAGHHKVHPDTIAAATRVLAEAKRKGTIIDFYVTHVGDDLQL
IMTHRKGVDSPEIHGLAWEAFKKAAEVAKELGLYAAGQDLLSDAFSGNVRGLGPGVAEME
FVERPSEPIVVFMADKTEPGAFNLPLYRIFADPFNTAGLVIDPRMHDGFKFEVLDVLEGK
YVVLNAPEELYDLLALIGTPSRYVIKRIYRKRDNEIAAVVSVERLNLIAGRYVGKDDPVA
IVRAQSGFPAVGEILEPFSFPHLVAGWMRGSHWGPLMPVSLRDAKCTRFDGPPRIVALGF
QVTKGKLIGPVDLFDDPAFDEARRLAQQIADYMRRHGPFMPHRLGPEEMEYTTLPQVLEK
LKNRFAEAKDYEKYIKPKIKKSELLTGEETHD

BLAST