GenomeNet

>hbu:Hbut_1550 conserved archaeal protein; K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] (A)
MTWIKNPEPWMVNLVAEKLGLDVERVETLARHGTIRFRGYRDVVYALLRREIAGHPEGTV
VLLERNGARLVPGYPPIQRMVLPTIALPRHFIDKVVVEEKMNGYNVRLVMFHRKLLAVTR
GGFICPYTTARLERLIGGRVRELFREIDPETYTIAGEVVGLENPYTRYFYPEAPRFDYFV
FDLFHELKPLPPLERNELLEKYGLKHVRLLGVIDKNDVEMFKQIVAELDREGREGVVAKD
PEYRVPPLKYTTSAVNIGDVRYGMRFFMEEGRSFLFSRLLRELFRAYEEGFGDAQLEKLA
LEFGRAATEPALESIRKVAMGDMLYEEFELVFADEVELEEFTSYMAELGVDIVVVSTSRE
DEGLRARMRKIKDTWIQLRKVLDTGLSPVD

BLAST