GenomeNet

>hbu:Hbut_1550 K07468 putative ATP-dependent DNA ligase [EC:6.5.1.1] | (GenBank) conserved archaeal protein (A)
MTWIKNPEPWMVNLVAEKLGLDVERVETLARHGTIRFRGYRDVVYALLRREIAGHPEGTV
VLLERNGARLVPGYPPIQRMVLPTIALPRHFIDKVVVEEKMNGYNVRLVMFHRKLLAVTR
GGFICPYTTARLERLIGGRVRELFREIDPETYTIAGEVVGLENPYTRYFYPEAPRFDYFV
FDLFHELKPLPPLERNELLEKYGLKHVRLLGVIDKNDVEMFKQIVAELDREGREGVVAKD
PEYRVPPLKYTTSAVNIGDVRYGMRFFMEEGRSFLFSRLLRELFRAYEEGFGDAQLEKLA
LEFGRAATEPALESIRKVAMGDMLYEEFELVFADEVELEEFTSYMAELGVDIVVVSTSRE
DEGLRARMRKIKDTWIQLRKVLDTGLSPVD

BLAST