GenomeNet

>hch:HCH_00996 Glutamate decarboxylase and related PLP-dependent protein; K01580 glutamate decarboxylase [EC:4.1.1.15] (A)
MSKTKKIAKASLETMYRVFTIPEAPNSTLGRIDQKISQNLAGFLQDHIVAVEKDLSEMEK
DFAESRIPEDPVFVSEQTQFLLDKLVSQSVHTASPSFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPLERQVIGMMHRLVYDRDDAYYHEWMHNSSVALGSMCSGGTVANITA
LWVARNLCFPADSVFKGVRREGMFKALKHYGYEGAAVLVSKRGHYSLSKSADLLGLGSDN
IIAIPTGANNKIDLQALRATCEKLRDANVRVISLVGIAGTTETGNIDPLEDMAAIAKEFN
TYFHVDAAWGGPTLFSNNYKHLLKGIELADSVTMDAHKQLYVPMGAGLVVFKTPSTSNAI
EHHAQYIIRQGSRDLGSKTLEGSRPGMAMLIQSGLKIIGRTGYEILIDLGIEKAKTFAAM
IDQADDFELVSEPELNILTYRYHPVWVRQAFEFADEERRQAINDCLSRITKGIQKTQRAR
GKAFVSRTRLNPAAYDGQACVVFRVVLANPLTTVEILQDILEEQRAIAAEDILSERMDEL
RNLCAIPTAKVAAS

BLAST