GenomeNet

>hch:HCH_00996 K01580 glutamate decarboxylase [EC:4.1.1.15] | (GenBank) Glutamate decarboxylase and related PLP-dependent protein (A)
MSKTKKIAKASLETMYRVFTIPEAPNSTLGRIDQKISQNLAGFLQDHIVAVEKDLSEMEK
DFAESRIPEDPVFVSEQTQFLLDKLVSQSVHTASPSFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPLERQVIGMMHRLVYDRDDAYYHEWMHNSSVALGSMCSGGTVANITA
LWVARNLCFPADSVFKGVRREGMFKALKHYGYEGAAVLVSKRGHYSLSKSADLLGLGSDN
IIAIPTGANNKIDLQALRATCEKLRDANVRVISLVGIAGTTETGNIDPLEDMAAIAKEFN
TYFHVDAAWGGPTLFSNNYKHLLKGIELADSVTMDAHKQLYVPMGAGLVVFKTPSTSNAI
EHHAQYIIRQGSRDLGSKTLEGSRPGMAMLIQSGLKIIGRTGYEILIDLGIEKAKTFAAM
IDQADDFELVSEPELNILTYRYHPVWVRQAFEFADEERRQAINDCLSRITKGIQKTQRAR
GKAFVSRTRLNPAAYDGQACVVFRVVLANPLTTVEILQDILEEQRAIAAEDILSERMDEL
RNLCAIPTAKVAAS

BLAST