GenomeNet

>hcm:HCD_08010 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) porA; pyruvate flavodoxin oxidoreductase subunit alpha (A)
MAKNIELQEVEVWDGCTASSQVLRQVQVDVVAAYPITPSSPIVQSYGIFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGFALMVEVLYQASGMRLPIVLNLANRALAAP
LNIHGDHSDMYLGRDAGWINLCTCNPQEVYDFTLMAFRIAEHERVRVPTIVNQDGFLCSH
TVQNVRPLSDAIAYKFVGEYQAKHSLFDFDRPVSYGAQAEEEWHYEHKAQLHHAIMNADG
VIEEVFNDFAKLTGRQYHLTETFQMEDAEVAIFAIGTTYESAIVAAKEMRKKGVKAGVAT
IRSLRPFPYKRLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQAEGSKHPVVSNYI
YGLGERDMTIAHLCEIFEEINQDALKGTLTHPTQQFIGLRGPKMSFF

BLAST