GenomeNet

>hcm:HCD_08010 porA; pyruvate flavodoxin oxidoreductase subunit alpha; K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MAKNIELQEVEVWDGCTASSQVLRQVQVDVVAAYPITPSSPIVQSYGIFKDNGYVDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGFALMVEVLYQASGMRLPIVLNLANRALAAP
LNIHGDHSDMYLGRDAGWINLCTCNPQEVYDFTLMAFRIAEHERVRVPTIVNQDGFLCSH
TVQNVRPLSDAIAYKFVGEYQAKHSLFDFDRPVSYGAQAEEEWHYEHKAQLHHAIMNADG
VIEEVFNDFAKLTGRQYHLTETFQMEDAEVAIFAIGTTYESAIVAAKEMRKKGVKAGVAT
IRSLRPFPYKRLGQDLKNLKALAILDKSSPAGAMGAMFNEVTSAVYQAEGSKHPVVSNYI
YGLGERDMTIAHLCEIFEEINQDALKGTLTHPTQQFIGLRGPKMSFF

BLAST