GenomeNet

>hde:HDEF_0718 tufB; protein chain elongation factor EF-Tu; possible GTP-binding factor (duplicate of tufA); K02358 elongation factor Tu (A)
MSKEKFERKKPHINVGTIGHVDHGKTTLTAAITTVLSKKYGGQARAFDQIDNAPEEKARG
ITINTSHVEYETPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLARQVGVPYILVFLNKCDMVDDAELLELVEMEVRELLSQYDFPGDDTPIIQGSALKALE
GDEAYQEKIVELANALDKYIPEPQRDIDKPFLLPIEDVFSISGRGTVVTGRVERGMIKTS
DSVEIVGIKDTVTTTCTGIEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIN
PHTKFEAEVYILTKEEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKML
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIK

BLAST