GenomeNet

>hde:HDEF_0862 mrcB; penicillin-binding protein 1b; K05365 penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-] (A)
MSHYGHEPIGQKNKKIHSKLHTSIKPKHSKKKWVFLRLLFILFLSAGLVVILYGFYLNEK
IRQRIDGQVWVLPAAVYGRMLNLEPGMAYSKKQMINLLIATQYRKVNHLLRVGEFTVQDN
SIDMLRRPFNFPDAKEDQVHARLLFHNDRLVQIENLDNQRFFGFFRLDPRLITMLQTPSG
EQRLFLPRSSFPESLVNTLLAIEDRHFYQHDGINFYSIGRALLANILAGRTVQGGSTLTQ
QLVKNLFLNNQRSFWRKANEAYMAILIDHHYSKDKILELYFNEVYLGQNGNDQIRGFPLA
SLYYFGRPVDELSLDQQAMLVGMVKGASLYNPWRNPEFTLERRNLVLKLLQNQGNIDEKL
YHTLSTRPLDVQPKGGVIVPQPAFIEMVRQELKQKLGDKAQHLSGAKIFTTMDPVSQDAA
EKAIESGIPALKGSEHDLSDLEGAMVVIDRLSGEIRAIVGGSQPQFSGFNRALQARRSIG
SLAKPAIYLSALNQPHQYRFNTWLFDQPLSLELPNGSVWEPKNYSRKFRGQVMLLDGLVD
SLNVPTVNLGMSIGLDQISQTMKQLGAPASTGPLMPSMLLGAINLTPLEVAQEYQTIASG
GNKATLSALRSVIAADGSMLYQSFPQSERKLSAQASYLVLYGMQEAVKRGTARSLSSEFS
TFHLAGKTGTTNDLRDSWFAGIDGKEVTIIWLGRDNNGPTQFTGSTGALTLYRRYLETKP
PLPLISRKPAGIVDMNIDSTTGHFICDTEPHNQISTIPVWTEDPDVLCKTSEKTTPPNEL
KEKSVLDSIKNIF

BLAST