GenomeNet

>hdn:Hden_0650 Glutathione S-transferase domain protein; K11209 GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-] (A)
MQDDGLDEPIKLYFWTTPNGYKIAIMLEELGTPYRTQFIDITKGEQFAPEFLAVSPNNRI
PAIVDPDGPDGQPLSIFESGAILQYLGRKFGAFYPSNERTKAEIDQWLFWQVGGLGPMAG
QYKHFKNVAPDKIPYAIDRYGKEVERLFGVLEKRLQGREYIAGTYSIADIANFTWTRVWA
DIGQDVRKFPNIEAWLARIAERPAVVRGLALKKPEAG

BLAST