GenomeNet

>hdn:Hden_2144 Glutathione S-transferase domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MLTLYYSPGACSLASHIALHEAGEKFDLVKVNLKTHALEDGRSFKDINPKGYVPALQFDN
GDVLTENVAILTKIADRHSTLAAPGKHGKYRLLEMLAFISSEVHKSFKPLFSANSTAEEK
QAAKDAIAKRLEFLAKHKPTSGTYLFGDNMTVADAYLFVMLLWAEKNGVKVPDALKKLAE
AMKARPTVHLALKHEGLAA

BLAST