GenomeNet

>hef:HPF16_0480 catalase-like protein; K03781 catalase [EC:1.11.1.6] (A)
MKKIGLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNPQ
AKEDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEVPSYKNFAAYTKTIGISSSVANTPYYSVH
TFKFKDKKEKLLPARWKFVPKDGVKYLNPQELKQKDSNYLLSSFQQHLKNKPIEYQMYLV
FANKNDATNDTTALWKGKHKELLVGTLKVEEYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFSRRQ

BLAST