GenomeNet

>hgl:101721908 Tgm3; transglutaminase 3 (E polypeptide, protein-glutamine-gamma-glutamyltransferase); K05620 transglutaminase 3 [EC:2.3.2.13] (A)
MSGGQCEKTVTPPRVTVYLRTSGSAFCVTALELQNVDWQVADNRRAHHTGQFSSREVILR
RGQSCNIVAFFNRALNSEEGLNLTAETGPNPSESARTKATFPVASGRSTGGSWAAEVMEN
NGNALTIAIYSPASAPIGRYTLSLQISSKGRVSSVKLGTFVLLFNPWLQADDVFMSNQAE
RQEYVEEDSGIIFVGSTNRIGMVGWNFGQYEEDILNISLSILDKSLNFRRDPGTDVARRN
DPKYVGRVLSAMINSNDDNGVIAGNWSGSYTGGLDPRNWNGSVEILKEWKKSGFRPVRFG
QCWVFAGTLNTVLRCLGIPSRVITNFNSAHDTDRNLSVDVYYDPMGNPLDKGSDSVWNFH
VWNEGWFVRNDLGPSYNGWQVLDATPQERSQGVFQCGPASVIAVREGDVDRNFDMPFIYS
EVNADRITWIYNASNGTQKQNSIDTRSVGRYISTKAVGSYSRMDITDKYKYPEDSNEERR
VQEKALSKLKPNPSFGATSAEDLPREERAPSISGRFKVNGVLAVGQEVNLALLLKNLASD
RKTVTVNMTAWTIVYNGTLVHEVWKGSATVSLDPEEEVQHPVKITYAQYDKYLKADNMIR
TTAVCKVSDEAEVVVERDIILDNPTLTLEVLDRARVRKPVNVQMLFSNPLDEPVKDCVLM
VEGSGLLRGNLKIEVPALRPKERSRVRFEILPTRSGTKQLLADFSCNKFPAIKAMLSIDV
VE

BLAST