GenomeNet

>hha:Hhal_1056 gltB; glutamate synthase subunit alpha (EC:1.4.1.13); K00265 glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14] (A)
MTDENAPGLYRPSFERDNCGFGLIAHMDGNPSHWLIETAVAALGRLTHRGAVAADGKTGD
GCGLLLTKPDAFLRAVAHEAGLDLDEQFAVGSLFLHPEEGFAEAAREALRQALRSQGLEP
AGFREVPVDTSALGAQALQTCPRIEQAFVNADPGMEAQDLERRLFIARRLTEKAISSEDE
VFYVASLSGRVLSYKGLVMPDYLPAFYQDLQDPRLASSLCVFHQRFSTNTLPQWRLAQPF
RYLAHNGEINTIQGNRNWANARAFTLNTPLIPDMEAVHPLVNSEGSDSSSLDNMLDVLLQ
GGMDIFRAMRLLMPPAWQNVDSMDADLRAFYEYHSMHCEPWDGPAGIVLTDGRHAACSLD
RNGLRPARWVMTRDRHITLASEIGVWDYDPAEVVAKGRLKPGEMLAADTETGQLLTPEQI
DERLMRRKPYKAWLSEHLRRLEPLAGFDGKSPQLDQNALDVHQKLFGISFEERDQVMKPM
AEGGQEAVGSMGDDTPLPVLSRRVRALYDTFRQQFAQVTNPAIDPLRERIVMSLETCLGR
EKNLFDESEDHAKRITVDSPVLSGAKFAAIKALDDPEYAHTVIDLTYDPSQLNLRSAIEA
VAAEAEAAVRAGSTLVVLSDRRVERGRLTIHALLATGAVHHRLVARGLRCNANLIVETGT
ARDPHHIGCLIGYGATCVYPYLAYEVVAEMARSGRMEGDVEALCLNYRKGLNKGLYKILS
KMGISTIASYRGAQLFESVGLADEVVDLCFTGTTNRIQGMNFSDLEADARELARRAHRAT
ELLDQGGVFKYVHGGEYHCYNPEVVSYLQQAVEDGDYATYKRFADAVNQRPTATLRDLLG
LKVPDQGIAVDEVQPIDDILTRFDSAGMSLGALSPEAHEALAMAMNRLGGRSNSGEGGED
PARYGTDRVSKIKQIASGRFGVTPHYLVNAEVLQIKVAQGAKPGEGGQLPGHKVNEMIAR
LRYSKPGVALISPPPHHDIYSIEDLAQLIFDLKQVNPEAQVSVKLVAEAGVGTVAAGVAK
AYADLITIAGYDGGTGASPLTSVKYAGGPWELGLTETHQTLRANDLRDKVRLQADGGMKT
GLDVVKGAILGAESFGFGTAPMVALGCKYLRICHLNNCATGVATQDNVLRLKHFVGTAEK
VANYFRFVAEETREWLALLGVRRLEDLIGRTDLLEVLPGETERQGRLDLSPILSDGGVPE
DKPKRCLEPSNVPFDKGELAEQMVADCLPTIEAGSGGEFHYTLRNNNRSIGARLSGEIAR
RHGNQGMADHPITLRLTGTAGQSFGVWNAGGLHMVLEGDANDYVGKGMAGGKLVLYPPQG
SRFEARKTTIMGNTCLYGATGGRLYAAGTVGERFGVRNSGATAVVEGVGDHGCEYMTGGV
VCVLGPTGVNFGAGMTGGLAFVLDEAGTFADRYNHELIDIHRLQSENMEAHRNYLRELIR
EFVAETGSVWGRAVLDDFRGYLPRFWLVKPKAADLHTILDTLRQAA

BLAST