GenomeNet

>hif:HIBPF18050 thymidine kinase/deoxyuridine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTVVYTAAIDDRFGVGKVTSRIGISQDAF
LFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLS
VCRLHYKEKCGQI

BLAST