GenomeNet

>hil:HICON_08900 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase/deoxyuridine kinase (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTVVYTAAIDDRFGVGKVTSRIGISQDAF
LFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLS
VCRLHYKEKCGQI

BLAST