GenomeNet

>hin:HI1040 ureF; urease accessory protein; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MLYYVPRREKSYMNIKPHLFGLNRSNRDFSLRETWGKNQFNSSFPVSLCCYMSSKGILAN
YLSIENAEIKCSSIDIKDVFEIEPENENTFFAFETSHSIKLTALPDHTTCDLTDADFGSE
IVIRPDSIVYLACSLAEILKESLANCMDIPNNVDHLDWSEPKQVIPLFPHILSTLNNLCS
RADTIQTPFLLQPVWKTLGKSPRLADNCLDIFIWSDVAFVKFILEISNLNVNVLSINRQT
RTAIWLYKMLVDIVKYGRFNHHKIIDLCSYNTKNDKAFASSGMITNVFMKSERLERPIIM
KSEIKNIILGGGQELLSPERRFDAIIYNSSELFR

BLAST