GenomeNet

>hin:HI1040 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) ureF; urease accessory protein (A)
MLYYVPRREKSYMNIKPHLFGLNRSNRDFSLRETWGKNQFNSSFPVSLCCYMSSKGILAN
YLSIENAEIKCSSIDIKDVFEIEPENENTFFAFETSHSIKLTALPDHTTCDLTDADFGSE
IVIRPDSIVYLACSLAEILKESLANCMDIPNNVDHLDWSEPKQVIPLFPHILSTLNNLCS
RADTIQTPFLLQPVWKTLGKSPRLADNCLDIFIWSDVAFVKFILEISNLNVNVLSINRQT
RTAIWLYKMLVDIVKYGRFNHHKIIDLCSYNTKNDKAFASSGMITNVFMKSERLERPIIM
KSEIKNIILGGGQELLSPERRFDAIIYNSSELFR

BLAST