GenomeNet

>hit:NTHI0655 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMSTLVYTAAIDDRFGVGKVTSRIGISQDAF
LFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLS
VCRLHYKEKCGQI

BLAST