GenomeNet

>hit:NTHI1786 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) haeIIR; type II restriction enzyme HaeII (EC:3.1.21.4) (A)
MNDIQVAKESLDKIIKKARVHLYKPIQIAEILYQDRVNKNINLLDKETYRNISKKWRDVI
CIRFLGRVSTSSAKYQDDLFNDNAMPPKHLNILGEMNRKTNGGVESYIYKKFFERFNQMS
SALEYSYSRTPDNFHLSEFLALFWLEPGLKRSIDKVYEIVVYALFSSLIEALGVKVKIDL
DLSNIDLLKEFEDFTRQIISLDSENTSLELNAKINRVGVTNASDRGLDMWANFGMAIQIK
HLSLTEELAENIVSSVSSDRIVIVCKESEEKLILSLLNQIGWRSKIQSIITEADLIKWYD
KALRGKSAYLVGSKILEHIRNEISLEFPATDIVDFNHFFHECEYNKALDIEK

BLAST