GenomeNet

>hiu:HIB_08140 sn-glycerol-3-phosphate dehydrogenase (anaerobic), membrane anchor subunit; K00112 glycerol-3-phosphate dehydrogenase subunit B [EC:1.1.5.3] (A)
MNFDVAIIGGGLAGLTCGIALQQRGKRCVIINNGQAAIDFASGSLDLLSRMPSTTYGENR
AVENLKENITALRNELPAHPYSLLGAEKVLAKAQDFERLANELNLDLIGSTEKNHWRVTG
LGSLRGAWLSPNSVPTVQGNEPFPHKRIAVLGIEGYHDFQPQLLAANLVLNPQFEHCEVT
SGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFNDLVKEIIESAQGAEAVFLPACFGLE
NQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFESLGGLMINGDSALNATFEGN
KVRCINTRLLENEEITADNFVLASGSFFSKGLISEFDKIYEPVFESDIIGVEGFNDKDRF
TWTAHRFAHPQPYQSAGVAINAQCQVKKCGQFLTNLYAVGNVIGGFNALELGCGSGVAVV
TALAVADEILAK

BLAST