GenomeNet

>hiu:HIB_13380 K10747 DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7] | (GenBank) unnamed protein product (A)
MSEKLDGVRGYWNGKQLLTRQGQPLSPPAYFIKDFPPFAIDGELFSERNHFEEISSITKS
FKGDGWAKLKLYVFDVPDAEGNLFERLAKLKAYLLEYPTTYIEIIKQIPVKDKTHLYQFL
AQVENLQGEGVVVRNPNASYERKRSSQILKLKTARDEECTVIAHHKGKGQFENVMGALTC
TNHRGEFKIGSGFNLNERENPPPIGSVITYKYRGITNSGKPRFATYWREKK

BLAST