GenomeNet

>hiu:HIB_13380 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MSEKLDGVRGYWNGKQLLTRQGQPLSPPAYFIKDFPPFAIDGELFSERNHFEEISSITKS
FKGDGWAKLKLYVFDVPDAEGNLFERLAKLKAYLLEYPTTYIEIIKQIPVKDKTHLYQFL
AQVENLQGEGVVVRNPNASYERKRSSQILKLKTARDEECTVIAHHKGKGQFENVMGALTC
TNHRGEFKIGSGFNLNERENPPPIGSVITYKYRGITNSGKPRFATYWREKK

BLAST