GenomeNet

>hla:Hlac_1567 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase (A)
MHAITRSGWIEVISGSMFSGKTEELLRRLRRSEIAGQSVAVYKPAVDDRYGETTIGSHNG
RQWEATVVDNEGGGPLAILDDEPFPEVVAIDEANFFSDALVEVCNALADNGTRVIVSGTD
QTFRGEPFEPLPELMATAEYVDKLQAICSQCGEPASRNQRLIEGEPAHVDDPTILVGAEE
SYEARCRDCHVLRTGERSEADRAYLNGERVAENGSEKQEEPIDSGATDD

BLAST