GenomeNet

>hmc:HYPMC_2434 DNA polymerase LigD, ligase domain-containing protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MRKAAPVKRPRSVPLKASALKSGRGLVSPSKIEGAVKSAMPSFVEPCLATLVAKPPIGEE
WVHEIKFDGYRIQARIDRNDVRLLTRNGLDWTDRFGGLAKALAEFHRGKAIIDGELVVED
ANGHSSFSALAAALKSGRSEKFVLHCFDLLYLDGLNLIGATLRDRKRLLEKLFVRRAKAG
PIRYSGHLAVDGARMLSDACSLGLEGIISKRIDRPYRSGRHDDWLKSKCIQVDEFVIVGY
LVSSAGPNAVGALVVGYYDKKRLIYAGRVGTGYTHRTAADLMRRLRPLHVDAPPVQGPLT
NLQRRDVVWVRPDLVAQIEYRAWTGDGLLRHAAFKGLREDKPAKDVRRPITKVIET

BLAST