GenomeNet

>hme:HFX_1601 glpC; glycerol-3-phosphate dehydrogenase (EC:1.1.5.3); K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] (A)
MSDAESPTNPNLNPGAQTDDFEAVEVFPESTDMDLRPGADNCYKCTACDVSCPVAEVDDE
FPGPKFQGPEQWRLKRKDDEPVDDSIMSCSNCMRCDDACPSGVPLSQMHNTARGEYVEKE
MDKLSREYIRNRILANYGTLAQLGSMFPRLTNAMMGNSLVQMVNEKVLGITSERDFPAFA
TQTFREWWNERGGPKVRSEEKRVAYFHGCYSNYNTPEVGKAMVRVFESFGYEVVVPKQRC
SGTPMFANGMLEDAKRAAGINVENFSGLLNEGYDVIASCTSCSMSLRQEYPELFDIDGIK
DVSEHTYEALEYLRIHENLEDELREVSVDDQSFAYHAPCHARNQGLDRQSVELFRELDGV
EIEDVGDSCSGISGTYGWKEEKYDKSMQIAADMFDHMEHAQGDVGMTECPTCSMQMEHGT
GYDIKHPLQLLEEALV

BLAST