GenomeNet

>hme:HFX_1601 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) glpC; glycerol-3-phosphate dehydrogenase subunit C (A)
MSDAESPTNPNLNPGAQTDDFEAVEVFPESTDMDLRPGADNCYKCTACDVSCPVAEVDDE
FPGPKFQGPEQWRLKRKDDEPVDDSIMSCSNCMRCDDACPSGVPLSQMHNTARGEYVEKE
MDKLSREYIRNRILANYGTLAQLGSMFPRLTNAMMGNSLVQMVNEKVLGITSERDFPAFA
TQTFREWWNERGGPKVRSEEKRVAYFHGCYSNYNTPEVGKAMVRVFESFGYEVVVPKQRC
SGTPMFANGMLEDAKRAAGINVENFSGLLNEGYDVIASCTSCSMSLRQEYPELFDIDGIK
DVSEHTYEALEYLRIHENLEDELREVSVDDQSFAYHAPCHARNQGLDRQSVELFRELDGV
EIEDVGDSCSGISGTYGWKEEKYDKSMQIAADMFDHMEHAQGDVGMTECPTCSMQMEHGT
GYDIKHPLQLLEEALV

BLAST