GenomeNet

>hmg:100205231 K05619 transglutaminase 1 [EC:2.3.2.13] | (RefSeq) hemocyte protein-glutamine gamma-glutamyltransferase-like (A)
MTSRPNSATLKPSTPNLLEDSSITFEVLPDEEEVPCKTYLVKCHTGNKYFSGTSAKVSIV
LHGNICASEKIVLEKPVSGKSPFQTGHFGINADVFEISTKDVGYLWKIDIGHDNSGFSPS
WYLIKVEVVDGDKTHKFLFNNWLYYSRTYHLLRVELETEEIPIVEIIPKLSEGDLTEHHT
LKFYKNFESDNPKPLIVRRGLSFDVLVRLAREYEAQKDSFYFSLSTGSNPREANKTKVIV
KELAPKYLSQAIEEKKWFYIIKSNDDPNSVLVQVFIPSNALVGEYLVVVEGESDSFKYPT
DKVYILFNPWNEDDEVFMESEEKRNEYIMRQFGIIYQGCWNSPVEKKWYFGQFEEVSLNT
AFYLLDNIPAKDRNAVGIARWISSLVSSNDENGILVGNWSGNYEDGTAPSHWNGSPAILR
KFYKRGIPVKYGQCWVFSGLITTILRTLGIPCRPVTNYLSAHESNGDCFHEIYYDEKGGK
ESGETIWNFHVWNEVWMKRLDLFDSKFDGWQAIDATPQEVDGGINQMGPAPLVAIKEGVM
DIKYDVPFVFSEVNANSVKWKKNEEESYDVIMYLTDAVGKRMSTKAVGIDEQDDSVINDY
KYVEGSIHEIAALKNALQSSGHEYAQKIYSSRNAKVFLSVLGNKEKFEMGDDIVLTVRIK
NTMNKEIEIPILLAGTIKRYNGSVIRALSNQNIPKVTVRKKDEKVIRIKVPAADYLKCVV
DDASLVFLVQADVTVKEKKYIIMEEVTFVITKPDLVITGLPEELYVGQTYEVVIPFNNII
GRNLTRCKLILDGTIVKKGFSVKLPDCPANEKTDFRFQITPEVVGKKKFNVTFNSLQLGG
LSGSHKAIVL

BLAST