GenomeNet

>hmo:HM1_3130 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) conserved domain protein (A)
MVFDLDPHESQSFQTVVEVALLLKSVLDTFGLTAYPKTSGASGMHIYVPVGDGYDYQTVR
KCAVTIAKFIEAVDPRVTLVRPIRDRGNRLYLDCWQIGRGKTVAGVYSLRPVPGAPVSTP
LLWSEVNRALQPKAFTMQTIFERLHRMGDLFRPVLEQKNDLAPLTKH

BLAST