GenomeNet

>hmr:Hipma_0797 K00169 pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1] | (GenBank) Pyruvate synthase (EC:1.2.7.1) (A)
MKKLVLGGNDAVAYAVKQSRVDVVSAYPITPQTSIIEKVASFIAKGEINTKFIRVESEHS
AMAAAMGASASGSRVFTATSSQGLLLMHEVLHWAAGAGLPIVMANANRAVAPPWSIWAEQ
TDSLSQRDTGWIQLYASNSQEVYDLVFIAFRLAEASLTPVMICMDGFLLTHTKEPVEVFD
NEIDEFISYKPERDILDVDKPKAFGALAFPKDYMPIRIKQHEKMLGSIDKFKTIADEFSL
ISKRSYGPIYQYGNENAKLAIVVSGSISETAHLSVDALNDEGIPSKLVKITMFRPFPKEA
LKKSLDGVDKIVVFDRNISMGKGGIFKDEIVGSLGLGNVVGVVCGLGGYDVNDMDIKETA
KSVFEGKIKQDTILWGEK

BLAST