GenomeNet

>hmr:Hipma_0797 pyruvate synthase (EC:1.2.7.1); K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MKKLVLGGNDAVAYAVKQSRVDVVSAYPITPQTSIIEKVASFIAKGEINTKFIRVESEHS
AMAAAMGASASGSRVFTATSSQGLLLMHEVLHWAAGAGLPIVMANANRAVAPPWSIWAEQ
TDSLSQRDTGWIQLYASNSQEVYDLVFIAFRLAEASLTPVMICMDGFLLTHTKEPVEVFD
NEIDEFISYKPERDILDVDKPKAFGALAFPKDYMPIRIKQHEKMLGSIDKFKTIADEFSL
ISKRSYGPIYQYGNENAKLAIVVSGSISETAHLSVDALNDEGIPSKLVKITMFRPFPKEA
LKKSLDGVDKIVVFDRNISMGKGGIFKDEIVGSLGLGNVVGVVCGLGGYDVNDMDIKETA
KSVFEGKIKQDTILWGEK

BLAST