GenomeNet

>hms:HMU12460 K03587 cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4] | (GenBank) pbpB; putative penicillin-binding protein (A)
MNEQSGRIVKVFSVFVVFIIIALLLCLFTLGKILGPNHIPFWQSKRIQVATRGSIYSDDN
FDLASSQVLYKVSINTLSIDPDKRELFINLFSIYSGMSREELQAKLKQKGYIVFSYNIPA
NVAANLRQLRSKLLAYDVFREYQDSSGRIVQKMGIDVEVSGINRNYAYNDALEPVLGYVK
KREARSVTIPEGVKGLEKYYNKELSPKQNGIERGDRDIRGNIIRNKTTILRERINGSDIA
LHVNLGLQRKVEKMLDEFYQQYQVDEIVAGVMDPKSGAIFALATTNRFDPKNITSNHALN
ASVTERPFEPGSTIKPIVFSILLDKNLINPLELIDLNKGFLQLGRYTIKDDIYPKKNSIV
QDILIRSSNVGMIKISRKLSGKEFYEGLKSFGISEASGIDLPYERDGVIPSIRKLSGEAY
KASASYGYGLTTTFIQLLRAYGVFCNNGILVTPHLIKNITDPDGKITTPTFPTRQAIAAP
TARKIQEILIKTVQEGTGKRAKIDNLIVGGKTGTARIAKSGGGYSDNIYNGSFFGFVKGG
NQTYVIGVVVFGTQHKEDYYGSQTAAPIFKEIARIMQKQNFFKEQK

BLAST