GenomeNet

>hms:HMU12460 pbpB; penicillin-binding protein; K03587 cell division protein FtsI (penicillin-binding protein 3) (A)
MNEQSGRIVKVFSVFVVFIIIALLLCLFTLGKILGPNHIPFWQSKRIQVATRGSIYSDDN
FDLASSQVLYKVSINTLSIDPDKRELFINLFSIYSGMSREELQAKLKQKGYIVFSYNIPA
NVAANLRQLRSKLLAYDVFREYQDSSGRIVQKMGIDVEVSGINRNYAYNDALEPVLGYVK
KREARSVTIPEGVKGLEKYYNKELSPKQNGIERGDRDIRGNIIRNKTTILRERINGSDIA
LHVNLGLQRKVEKMLDEFYQQYQVDEIVAGVMDPKSGAIFALATTNRFDPKNITSNHALN
ASVTERPFEPGSTIKPIVFSILLDKNLINPLELIDLNKGFLQLGRYTIKDDIYPKKNSIV
QDILIRSSNVGMIKISRKLSGKEFYEGLKSFGISEASGIDLPYERDGVIPSIRKLSGEAY
KASASYGYGLTTTFIQLLRAYGVFCNNGILVTPHLIKNITDPDGKITTPTFPTRQAIAAP
TARKIQEILIKTVQEGTGKRAKIDNLIVGGKTGTARIAKSGGGYSDNIYNGSFFGFVKGG
NQTYVIGVVVFGTQHKEDYYGSQTAAPIFKEIARIMQKQNFFKEQK

BLAST