GenomeNet

>hne:HNE_1947 K01283 peptidyl-dipeptidase A [EC:3.4.15.1] | (GenBank) angiotensin-converting enzyme family protein (A)
MMRHVFKPALKSASLIAIGLALAACGPAKTTIDPDAIAMEERAIEARAFLDDAESQIAAK
SHIAAQAYWDQATNITPETSAAAAQQGAEFTKLVVSLANASKDFDVSELPPAEARKLQIL
RSGITLPAPSREGAAEELADITTKLDATYSTGKFMFQGREIDLLEASRIIQESRDPEELK
AVWEGWHSIAAPMAPDYTRMVEIANEGARELGYPSLDQMWLSNYDMPPAQMEAEVQRLWS
QVEPLYKELHCYTRGRLNSYYGEAVQPAAGPIRADLLGNMWAQQWSGVYDILQTDTPGPS
YDLSERLNEKGYTPLQMVQTAEAFFTSLGLQALPQTFWERSMITKPEGREVVCHASAWDL
DDFEDVRIKMCTQVNAEDFQTVHHELGHNYYQLAYRNQDHLYKNGAHDGFHEAIGDFVAL
SITPEYLEQIGLITAEEKPGADADTALLLNTALDKIAFLPFALSVDSWRWDVLSGETAPE
NYNQSWTDIRLKNQGIIPPGPRPADAFDPGAKYHIPGNTPYLRYFLSFIMQFQFHKAACE
QAGWEGPLHRCSIYGNKEVGRRFEEMMEAGMSQPWPDTLEKFTGTREMDGSAIIEYFDPL
MVYLKEENAGQSCGW

BLAST