GenomeNet

>hor:Hore_03410 DNA polymerase LigD polymerase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MKLTIGKHDVQLTNLDKVLWPELGYTKGDLINYYINMYPYLKEYLLNRPLSMKSYPDGIN
GKSFYQKDCPDYAPHWLSTYGIFSGHRKDIINWVTINKLSDLVWVANRASIELHTWFSTT
TNLDKPDFAVFDLDPGSKSSMKDVVDIALTIKNILDEFNVRSFVKTSGKRGLHVYIPVKT
RYTYKEIRSFLQNVAEMVIKLKPEQATVEWRKNKRQGKVYIDYRQNGKSKTLPAPYSLRP
TSKATVSTPLKWSEITPDLNPDNYNIKNIETRIKQKGNIWETLLKIRQELPGLFLGLLLF
LSFSLFGGLNTFL

BLAST