GenomeNet

>hpa:HPAG1_1150 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) iceA1 (A)
MIKKRQICKECKETGYRFDATKIPGNYYSFYEGEAEYDGCVGCYQYDPIQYRKTCNDRIF
NEGYQKGYGEGYQIGYHQKTTL

BLAST