GenomeNet

>hpa:HPAG1_1151 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) iceA1 (EC:3.1.21.4) (A)
MSKSKKELFLELAQPDKNGVSRWASVTEFVGKYQGLQLGNGGSWFRNNSSLAKEFKLEFD
KGQTLGNSIDRIRLNGYNTECVFNQSIRQDIKNYYKQQCCTMCGARGNSENTQIEVDHKD
DRKNDLRVSDSNTQTFDDFQALYKACND

BLAST