GenomeNet

>hpk:Hprae_0077 pyruvate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1); K00169 pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1] (A)
MSIREKLSGNEAAAIALKQINPDVMAAFPITPSTEIPQYFSKYVANGSVDTEFVPVESEH
SAMSACVGSQAAGARTVTATSSCGLALMFEELYIASSSRLPIILSVVNRALSGPININAD
HSDSMGARDSGWIQLYSEDNQEAYDNLIQAVRIGEHEDVQLPVMVCQDGFITSHAIENIE
LLEKEVVQDFVGDYQAKEYLLNKDNPIAMGPYDTADYYMEHKYQQNRAMENAKAVIEKIA
AEFKEISGREYDFFETYKLEDADYAMVVLNSTAGTAKAAIDKMRAEGKKVGLLKIRVFRP
FNAEKLTELLKDIKYVAVMDRSETFSTAGGPVFHETSAALYPLAERPELISYIYGLGGRD
VTIESVESVFNDLMEIEKAGEVKNRYRYLGLRE

BLAST