GenomeNet

>hpk:Hprae_1976 thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MYKITKSGWLEIITGPMYCGKSEELIRRLNRVKIAKQKVRVFKPVLDDRYSKKDVVSHSG
NSIEAVPVDHPEEILKRIDKTVDVVGIDEAQFFHSDLVAICEELADEGIRVILAGLDRDF
RNQPFGPMPELMARAEYVDKLHAICIQCGEPASRTQRLINGQPARADDPVILVGAAEVYE
ARCRSCHSLRTD

BLAST