GenomeNet

>hpo:HMPREF4655_20862 D-ala D-ala ligase N-terminal domain protein; K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] (A)
MQSFLGSLIVEFCVLFGGASFEHEISIVSAIALKEALKDRIKYFIFLDENHHFYLIEESN
MHSKYFAQIKEKKLPPLILTRNGLLKNSFLGTKIIELPLVINLVHGGDGEDGKLASLLEF
YRIAFIGPRIEASVLSYNKYLTKLYAKDLGVKTLDYVLLNEKNRANALNLIGFNFPFIVK
PSNAGSSLGVSVVKEEKELIYALDGAFEYSKEVLIEPFIQGVKEYNLAGCKIKKDFCFSY
IEEPNKQEFLDFKQKYLDFSRNKAPKANLSNALEEQLKENFKKLYNDLFDGALVRCDFFV
IENEVYLNEINPIPGSLANYLFDDFKTTLENLVQSLPKTPKIPIKNSYLLQIQKNK

BLAST