GenomeNet

>hpp:HPP12_1174 K01155 type II restriction enzyme [EC:3.1.21.4] | (GenBank) type II R-M system restriction endonuclease (A)
MLCGVRGNSENTQIEVDYKDGHKDDSRVSDLNAQTFDDFQALCKACNDKKRQICKKCKEN
GYRFDARKIPGNYYSFYEGEAEYDGCVGCYQYDPIQYRKTCNDRIFNEGYQKGYNWGYQI
GYHQKTTL

BLAST