GenomeNet

>hpp:HPP12_1174 type II R-M system restriction endonuclease; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MLCGVRGNSENTQIEVDYKDGHKDDSRVSDLNAQTFDDFQALCKACNDKKRQICKKCKEN
GYRFDARKIPGNYYSFYEGEAEYDGCVGCYQYDPIQYRKTCNDRIFNEGYQKGYNWGYQI
GYHQKTTL

BLAST