GenomeNet

>hpr:PARA_07960 thymidine kinase/deoxyuridine kinase; K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYRERNMNTMVYTAAIDDRFGLGKVTSRIGIHEDAN
LFTSTSDLFAEVRQHLQQEKIHCVLVDEAQFLTKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGEVIKEGEQIQIGGNDSYLS
VCRYHYKEKCGQL

BLAST