GenomeNet

>hpr:PARA_07960 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) thymidine kinase/deoxyuridine kinase (A)
MAKLYFYYSTMNAGKSTTLLQSSYNYRERNMNTMVYTAAIDDRFGLGKVTSRIGIHEDAN
LFTSTSDLFAEVRQHLQQEKIHCVLVDEAQFLTKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNEQGEVIKEGEQIQIGGNDSYLS
VCRYHYKEKCGQL

BLAST