GenomeNet

>hpt:HPSAT_02320 K03781 catalase [EC:1.11.1.6] | (GenBank) catalase-like protein (A)
MKKISLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNPQ
ARKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEVPSYRNFAAYTKTIGISSSVANTPYYSVH
AFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKNSNYLLSSFQQHLKTKPIEYQMYLV
FANKNDATNDTTVLWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFNRRQ

BLAST