GenomeNet

>hpt:HPSAT_02320 catalase-like protein; K03781 catalase [EC:1.11.1.6] (A)
MKKISLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNPQ
ARKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEVPSYRNFAAYTKTIGISSSVANTPYYSVH
AFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKNSNYLLSSFQQHLKTKPIEYQMYLV
FANKNDATNDTTVLWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFNRRQ

BLAST