GenomeNet

>hpy:HP0091 K01155 type II restriction enzyme [EC:3.1.21.4] | (RefSeq) type II restriction enzyme R protein HsdR (A)
MKNHLPFDIFLKSLKTSNRTLDFFTDWQKCLKNKNKISIALNHLNFLLGKDTKELKNCIK
SLFKEYPKAFNVLNILIAVRDKKDIVLDANGNFYPLYSYFEDGEKVYEFIRQTGLERIFC
NRNIKDLNDFVFGIEVGLDSNARKNRSGKVMENHLSGLFTNAQLNFKEQVEIREFEDLCQ
AFGDDIKKFDFVVCGKDKTYFIEANFYTISGSKLNEVARSYQDLALKFEAFPNYEFIWIT
DGIGWLDAKNKLQEAYKSVEIYNLSNVNDFISKAQKW

BLAST