GenomeNet

>hpy:HP1366 type IIS restriction enzyme R protein; K01155 type II restriction enzyme [EC:3.1.21.4] (A)
MPKLEKILLEITQLDPSKECLKFLANRIKSSDYRGLHLSQHNRYDQNKIKTIIQAIFNEV
GGDFLQIRTTDMSKRPSNIIGEEIYAKVVDNICKSEMPQDNSGKKNQVTQDSLRKNLFVD
MHRMGLIERYNKNKEPTNPYIQSNIKYISLTPLAIEFLNAQDLLRKNFCYTQALENLLQG
FGAECREVMIELDNHYLDIEEMMFFVTFLNIENFTRSEIIEYVRGYRSLSRIQKEKLKEL
VQDYCNPNHFNGNKLEKRDYHNWKNQAQQIFSLLEQSVFFETNKERLILKALNEENKQND
KKLKRSIKEKALYFEKHGVKKEKGFELHHIVPLCLARSIEEFDLLDKWENLIYIDAFNHA
KISQTQNKHICLYFKNCDVVLSKGLKEEQESLYLTYIENVLYKLDLQNAMLKYNKDLLHS
KNG

BLAST