GenomeNet

>hpz:HPKB_0994 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) hypothetical protein (A)
MNNLNNLIKGTDFEKSSLFAILTKSSGGVFNNAAQIYNHDFYWDCLSPKATALSDELKGA
LEKDFGSLEKFKEDFIKSATTLFGSGWNWAAYNLDTQKIEIIQTSNAQTPVTDKKVPLLV
VDVWEHAYYIDHKNARPVYLEKFYGHINWHFVSQCYEWAKKEGLGSVDYYINELVHKKA

BLAST