GenomeNet

>hru:Halru_1791 4-aminobutyrate aminotransferase family protein; K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] (A)
MDRDTVEPSVETMPGPRAEKWADYHHQFSAPSTYVYDFVWDTSAPATGPFCTDVDGNVLL
DFTSHVAAAPLGYNNPTLRKKLDEFDLPDPTKIAGQDFYVSSDWPPEDSDQPGPTELMDR
LTDLTSHYDMDTVFLSNSGAEAVENAIKICYTRGGHRGVTTEGAFHGRTLGALSLNRSKT
VQRKGYPEIPGVISIPYPSTDEAYEQRWQTDGPGGNVLADKLHPKQGVIDADELAYVILE
PVQGEGGYRPAHPEFARDLQALRERYDVAVIADEIQSGMGRTGKMWGVDHLDLTPDVITS
AKGLRVGATISRSDVFPEETGRISSTWGAGDLLASFQGALTIDIIQEQNLLENVQARGRQ
LRETVVDANLPGVTDVRGPGLMIGVEFDEKERREAVVKAALERGLLTLGCGHRTVRLLPP
LDVTEREIDIAADLFEAAAEAADRSVTPAATDGGQ

BLAST