GenomeNet

>hru:Halru_1791 K00823 4-aminobutyrate aminotransferase [EC:2.6.1.19] | (GenBank) 4-aminobutyrate aminotransferase family protein (A)
MDRDTVEPSVETMPGPRAEKWADYHHQFSAPSTYVYDFVWDTSAPATGPFCTDVDGNVLL
DFTSHVAAAPLGYNNPTLRKKLDEFDLPDPTKIAGQDFYVSSDWPPEDSDQPGPTELMDR
LTDLTSHYDMDTVFLSNSGAEAVENAIKICYTRGGHRGVTTEGAFHGRTLGALSLNRSKT
VQRKGYPEIPGVISIPYPSTDEAYEQRWQTDGPGGNVLADKLHPKQGVIDADELAYVILE
PVQGEGGYRPAHPEFARDLQALRERYDVAVIADEIQSGMGRTGKMWGVDHLDLTPDVITS
AKGLRVGATISRSDVFPEETGRISSTWGAGDLLASFQGALTIDIIQEQNLLENVQARGRQ
LRETVVDANLPGVTDVRGPGLMIGVEFDEKERREAVVKAALERGLLTLGCGHRTVRLLPP
LDVTEREIDIAADLFEAAAEAADRSVTPAATDGGQ

BLAST