GenomeNet

>hsa:1032 CDKN2D, INK4D, p19, p19-INK4D; cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4); K06623 cyclin-dependent kinase inhibitor 2D (A)
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALEL
LKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHT
AVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

BLAST