GenomeNet

>hsa:11315 K05687 protein DJ-1 | (RefSeq) PARK7, DJ-1, DJ1, HEL-S-67p; Parkinsonism associated deglycase (A)
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLED
AKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFG
SKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQ
VKAPLVLKD

BLAST