GenomeNet

>hsa:504191 OR9G9, OR9G1; olfactory receptor family 9 subfamily G member 9; K04257 olfactory receptor (A)
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF
VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD
RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL
LPLVKLACGEKGGYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC
SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEAL
KKLLP

BLAST