GenomeNet

>hsa:504191 K04257 olfactory receptor | (RefSeq) OR9G9, OR9G1; olfactory receptor family 9 subfamily G member 9 (A)
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF
VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD
RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL
LPLVKLACGEKGGYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC
SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEAL
KKLLP

BLAST