GenomeNet

>hsa:504191 OR9G9; olfactory receptor, family 9, subfamily G, member 9; K04257 olfactory receptor (A)
MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF
VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD
RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL
LPLVKLACGEKGGYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC
SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPMLNPMIYSLRNKDVKEAL
KKLLP

BLAST