GenomeNet

>hsa:5879 RAC1, Rac-1, TC-25, p21-Rac1; ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1); K04392 Ras-related C3 botulinum toxin substrate 1 (A)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

BLAST