GenomeNet

>hsa:5879 K04392 Ras-related C3 botulinum toxin substrate 1 | (RefSeq) RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1; Rac family small GTPase 1 (A)
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL

BLAST